Tmem50b Antibody - N-terminal region (ARP60093_P050)

Data Sheet
 
Product Number ARP60093_P050
Product Page www.avivasysbio.com/tmem50b-antibody-n-terminal-region-arp60093-p050.html
Name Tmem50b Antibody - N-terminal region (ARP60093_P050)
Protein Size (# AA) 158 amino acids
Molecular Weight 18kDa
NCBI Gene Id 77975
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transmembrane protein 50B
Alias Symbols AU015466, AU019872, B230114J08Rik
Peptide Sequence Synthetic peptide located within the following region: PKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein is unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tmem50b (ARP60093_P050) antibody
Blocking Peptide For anti-Tmem50b (ARP60093_P050) antibody is Catalog # AAP60093
Uniprot ID Q9D1X9
Protein Name Transmembrane protein 50B
Protein Accession # NP_084294
Purification Affinity Purified
Nucleotide Accession # NM_030018
Tested Species Reactivity Mouse
Gene Symbol Tmem50b
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Mouse Heart
WB Suggested Anti-Tmem50b Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com