| Product Number |
ARP60065_P050 |
| Product Page |
www.avivasysbio.com/c1qc-antibody-middle-region-arp60065-p050.html |
| Name |
C1QC Antibody - middle region (ARP60065_P050) |
| Protein Size (# AA) |
245 amino acids |
| Molecular Weight |
26 kDa |
| NCBI Gene Id |
714 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
complement component 1, q subcomponent, C chain |
| Alias Symbols |
C1QG, C1Q-C |
| Peptide Sequence |
Synthetic peptide located within the following region: GKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. |
| Protein Interactions |
FN1; APOA1; PTX3; FKBP2; C1QB; C1QA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C1QC (ARP60065_P050) antibody |
| Blocking Peptide |
For anti-C1QC (ARP60065_P050) antibody is Catalog # AAP60065 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human C1QC |
| Uniprot ID |
P02747 |
| Protein Name |
Complement C1q subcomponent subunit C |
| Protein Accession # |
NP_758957.2 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C1QC |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human Ovary Tumor
 | WB Suggested Anti-C1QC antibody Titration: 1 ug/mL
Sample Type: Human Ovary Tumor |
|
|
