FGFR2 Antibody - middle region (ARP60045_P050)

• Product Number: ARP60045_P050
• Name: FGFR2 Antibody - middle region (ARP60045_P050)
• Protein Size (# AA): 705 amino acids
• Molecular Weight: 78kDa
• NCBI Gene Id: 2263
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fibroblast growth factor receptor 2
• Alias Symbols: BEK, JWS, BBDS, CEK3, CFD1, ECT1, KGFR, TK14, TK25, BFR-1, CD332, K-SAM
• Peptide Sequence: Synthetic peptide located within the following region: KHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
• Protein Interactions: PPM1A; APP; HGS; UBC; LYN; FYN; CBL; NEDD4; FRS2; STAT5B; STAT5A; PGR; STAT3; ITGA5; PAK4; FGF23; FGF18; FGF17; EPHA4; FGF10; PTK2B; FGF9; FGF8; PLCG1; FGF5; FGF4; FGF3; FGF7; FGF6; FGF1; CACNA1D; PIK3R1; FGFR2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FGFR2 (ARP60045_P050) antibody is Catalog # AAP60045 (Previous Catalog # AAPP46195)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGFR2
• Uniprot ID: P21802
• Protein Name: Fibroblast growth factor receptor 2
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that FGFR2 is expressed in 721_B

• Protein Accession #: NP_075259
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022970
• Tested Species Reactivity: Human
• Gene Symbol: FGFR2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
• Image 1: Human 721_B
  
  WB Suggested Anti-FGFR2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that FGFR2 is expressed in 721_B