CLN5 Antibody - C-terminal region : Biotin (ARP59986_P050-Biotin)

Data Sheet
 
Product Number ARP59986_P050-Biotin
Product Page www.avivasysbio.com/cln5-antibody-c-terminal-region-biotin-arp59986-p050-biotin.html
Name CLN5 Antibody - C-terminal region : Biotin (ARP59986_P050-Biotin)
Protein Size (# AA) 358 amino acids
Molecular Weight 39 kDa
Conjugation Biotin
NCBI Gene Id 1203
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ceroid-lipofuscinosis, neuronal 5
Alias Symbols NCL
Peptide Sequence Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Interactions ARHGAP36; FBXO27; SPNS1; SFXN3; SLC25A22; SEC61A1; FBXO6; PHGDH; GANAB; OS9; CDIPT; SLC25A13; CDS2; SLC25A11; XPO1; SLC25A1; SEL1L; RPN1; RCN2; HMGCS1; DBH; CLN5; CLGN; CANX; CALU; CALR; ATP2A2; ATP1A3; ARF4; SLC25A6; SLC25A5; SLC25A4; Dlg4; UBC; KRT8;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CLN5 (ARP59986_P050-Biotin) antibody
Blocking Peptide For anti-CLN5 (ARP59986_P050-Biotin) antibody is Catalog # AAP59986
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
Uniprot ID O75503
Protein Name ceroid-lipofuscinosis neuronal protein 5
Protein Accession # NP_006484
Purification Affinity purified
Nucleotide Accession # NM_006493.2
Gene Symbol CLN5
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com