CLN5 Antibody - C-terminal region (ARP59986_P050)

Data Sheet
 
Product Number ARP59986_P050
Product Page www.avivasysbio.com/cln5-antibody-c-terminal-region-arp59986-p050.html
Product Name CLN5 Antibody - C-terminal region (ARP59986_P050)
Size 100 ul
Gene Symbol CLN5
Alias Symbols NCL
Protein Size (# AA) 358 amino acids
Molecular Weight 39 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1203
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name ceroid-lipofuscinosis, neuronal 5
Peptide Sequence Synthetic peptide located within the following region: DNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKN
Description of Target This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
Protein Interactions ARHGAP36; FBXO27; SPNS1; SFXN3; SLC25A22; SEC61A1; FBXO6; PHGDH; GANAB; OS9; CDIPT; SLC25A13; CDS2; SLC25A11; XPO1; SLC25A1; SEL1L; RPN1; RCN2; HMGCS1; DBH; CLN5; CLGN; CANX; CALU; CALR; ATP2A2; ATP1A3; ARF4; SLC25A6; SLC25A5; SLC25A4; Dlg4; UBC; KRT8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-CLN5 (ARP59986_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-CLN5 (ARP59986_P050) antibody is Catalog # AAP59986
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLN5
Complete computational species homology data Anti-CLN5 (ARP59986_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLN5.
Swissprot Id O75503
Protein Name ceroid-lipofuscinosis neuronal protein 5
Protein Accession # NP_006484
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLN5.
Nucleotide Accession # NM_006493.2
Replacement Item This antibody may replace item sc-134808 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
Image 1
Human Lung Tumor
Host: Rabbit
Target Name: CLN5
Sample Tissue: Human Lung Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com