| Product Number |
ARP59953_P050 |
| Product Page |
www.avivasysbio.com/adora2a-antibody-c-terminal-region-arp59953-p050.html |
| Name |
ADORA2A Antibody - C-terminal region (ARP59953_P050) |
| Protein Size (# AA) |
412 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
135 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Adenosine A2a receptor |
| Alias Symbols |
A2aR, RDC8, ADORA2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. |
| Protein Interactions |
NAMPT; Actn1; Actn4; Actn3; Actn2; ADORA2A; CYTH2; DRD2; ADA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADORA2A (ARP59953_P050) antibody |
| Blocking Peptide |
For anti-ADORA2A (ARP59953_P050) antibody is Catalog # AAP59953 (Previous Catalog # AAPP46115) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2A |
| Uniprot ID |
P29274 |
| Protein Name |
Adenosine receptor A2a |
| Sample Type Confirmation |
ADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226 |
| Protein Accession # |
NP_000666 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000675 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADORA2A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 80%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human RPMI 8226
 | WB Suggested Anti-ADORA2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: RPMI 8226 cell lysateADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226 |
| | Image 2 | Human Oral Carcinoma
 | Sample type -- oral cell carcinoma Dilution -- 5ug/mL |
|
|
