| Product Number |
ARP59892_P050 |
| Product Page |
www.avivasysbio.com/haus8-antibody-n-terminal-region-arp59892-p050.html |
| Name |
HAUS8 Antibody - N-terminal region (ARP59892_P050) |
| Protein Size (# AA) |
410 amino acids |
| Molecular Weight |
45kDa |
| Subunit |
8 |
| NCBI Gene Id |
93323 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
HAUS augmin-like complex, subunit 8 |
| Alias Symbols |
DGT4, HICE1, NY-SAR-48 |
| Peptide Sequence |
Synthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]). |
| Protein Interactions |
UBC; APP; HAUS6; HAUS5; Haus4; Haus1; Haus2; Plk1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HAUS8 (ARP59892_P050) antibody |
| Blocking Peptide |
For anti-HAUS8 (ARP59892_P050) antibody is Catalog # AAP59892 (Previous Catalog # AAPP46051) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HAUS8 |
| Uniprot ID |
Q9BT25 |
| Protein Name |
HAUS augmin-like complex subunit 8 |
| Protein Accession # |
NP_219485 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033417 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HAUS8 |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 75% |
| Image 1 | Human HeLa
 | WB Suggested Anti-HAUS8 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate |
|
|
