| Product Number |
ARP59810_P050 |
| Product Page |
www.avivasysbio.com/neto1-antibody-c-terminal-region-arp59810-p050.html |
| Name |
NETO1 Antibody - C-terminal region (ARP59810_P050) |
| Protein Size (# AA) |
533 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
81832 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuropilin (NRP) and tolloid (TLL)-like 1 |
| Alias Symbols |
BCTL1, BTCL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Protein Interactions |
BAG3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NETO1 (ARP59810_P050) antibody |
| Blocking Peptide |
For anti-NETO1 (ARP59810_P050) antibody is Catalog # AAP59810 (Previous Catalog # AAPP45969) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1 |
| Uniprot ID |
Q8R4I7 |
| Protein Name |
Neuropilin and tolloid-like protein 1 |
| Protein Accession # |
NP_620416 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138966 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
NETO1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-NETO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate |
|
| Image 2 | Mouse
 | Immunohistochemistry with mice retinal neurons tissue at an antibody concentration of researcher doesn't say using anti-NETO1 antibody (ARP59810_P050) |
|
| Image 3 | Human Brain, HeLa Cell Lysate
 | Host: Rabbit
Target: NETO1
Positive control (+): Human Brain (BR)
Negative control (-): HeLa Cell Lysate (HL)
Antibody concentration: 1ug/ml |
|
