| Product Number |
ARP59627_P050 |
| Product Page |
www.avivasysbio.com/taar5-antibody-middle-region-arp59627-p050.html |
| Name |
TAAR5 Antibody - middle region (ARP59627_P050) |
| Protein Size (# AA) |
337 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
9038 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Trace amine associated receptor 5 |
| Alias Symbols |
PNR, taR-5 |
| Peptide Sequence |
Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TAAR5 (ARP59627_P050) antibody |
| Other Applications Image 1 Data |
Immunofluorescence: Dilution -- 3ug/mL |
| Blocking Peptide |
For anti-TAAR5 (ARP59627_P050) antibody is Catalog # AAP59627 (Previous Catalog # AAPP45736) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TAAR5 |
| Uniprot ID |
Q5QD28 |
| Protein Name |
Trace amine-associated receptor 5 |
| Sample Type Confirmation |
TAAR5 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_003958 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003967 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TAAR5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IF, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Spinal Cord
 | Sample Type : Spinal Cord, ventral horns
|
|
| Image 2 | Mouse Spinal Cord
 | Immunofluorescence: Dilution -- 3ug/mL |
|
| Image 3 | Human 293T
 | WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysateTAAR5 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
