Stx2 Antibody - middle region (ARP59532_P050)

Data Sheet
 
Product Number ARP59532_P050
Product Page www.avivasysbio.com/stx2-antibody-middle-region-arp59532-p050.html
Name Stx2 Antibody - middle region (ARP59532_P050)
Protein Size (# AA) 289 amino acids
Molecular Weight 33kDa
NCBI Gene Id 13852
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Syntaxin 2
Alias Symbols Ep, Syn, rep, Epim, Syn-2, repro34, AW538950, G1-536-1
Peptide Sequence Synthetic peptide located within the following region: RQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Stx2 is essential for epithelial morphogenesis. It may mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Stx2 (ARP59532_P050) antibody
Blocking Peptide For anti-Stx2 (ARP59532_P050) antibody is Catalog # AAP59532
Uniprot ID Q00262
Protein Name Syntaxin-2
Protein Accession # NP_031967
Purification Affinity Purified
Nucleotide Accession # NM_007941
Tested Species Reactivity Mouse
Gene Symbol Stx2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Mouse Liver
WB Suggested Anti-Stx2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com