Stx1a Antibody - N-terminal region (ARP59486_P050)

Data Sheet
 
Product Number ARP59486_P050
Product Page www.avivasysbio.com/stx1a-antibody-n-terminal-region-arp59486-p050.html
Name Stx1a Antibody - N-terminal region (ARP59486_P050)
Protein Size (# AA) 288 amino acids
Molecular Weight 33kDa
NCBI Gene Id 20907
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Syntaxin 1A (brain)
Alias Symbols HPC-, HPC-1
Peptide Sequence Synthetic peptide located within the following region: EFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Stx1a is potentially involved in docking of synaptic vesicles at presynaptic active zones. It may play a critical role in neurotransmitter exocytosis. It may mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.
Protein Interactions Vapb; Vps18; Vps16; Vps11; Stxbp2; Stxbp1; Cacna1d; Vamp2; Snap25; Htt; Snca; Slc6a3; Ppp1cc; Ubc; Stx1a;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Stx1a (ARP59486_P050) antibody
Blocking Peptide For anti-Stx1a (ARP59486_P050) antibody is Catalog # AAP59486
Uniprot ID O35526
Protein Name Syntaxin-1A
Protein Accession # NP_058081
Purification Affinity Purified
Nucleotide Accession # NM_016801
Tested Species Reactivity Mouse
Gene Symbol Stx1a
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 92%
Image 1
Mouse Heart
WB Suggested Anti-Stx1a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com