SERPINA4 Antibody - middle region (ARP59241_P050)

Data Sheet
 
Product Number ARP59241_P050
Product Page www.avivasysbio.com/serpina4-antibody-middle-region-arp59241-p050.html
Name SERPINA4 Antibody - middle region (ARP59241_P050)
Protein Size (# AA) 427 amino acids
Molecular Weight 48kDa
NCBI Gene Id 5267
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
Alias Symbols KAL, KST, PI4, KLST, PI-4, kallistatin
Peptide Sequence Synthetic peptide located within the following region: KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SERPINA4 inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
Protein Interactions FN1; RASA1; MAP4K2; MAPK6; ILK; NR4A1; YAE1D1; GADD45G; TAB1; TNFRSF14; TNNT1; KLK2; KLK1; CTSD;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SERPINA4 (ARP59241_P050) antibody
Blocking Peptide For anti-SERPINA4 (ARP59241_P050) antibody is Catalog # AAP59241 (Previous Catalog # AAPP45230)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SERPINA4
Uniprot ID P29622
Protein Name Kallistatin
Protein Accession # NP_006206
Purification Affinity Purified
Nucleotide Accession # NM_006215
Tested Species Reactivity Human
Gene Symbol SERPINA4
Predicted Species Reactivity Human, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Zebrafish: 75%
Image 1
Human MCF-7
WB Suggested Anti-SERPINA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com