TIMP2 Antibody - N-terminal region (ARP59180_P050)

Data Sheet
 
Product Number ARP59180_P050
Product Page www.avivasysbio.com/timp2-antibody-n-terminal-region-arp59180-p050.html
Name TIMP2 Antibody - N-terminal region (ARP59180_P050)
Protein Size (# AA) 220 amino acids
Molecular Weight 22kDa
NCBI Gene Id 7077
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name TIMP metallopeptidase inhibitor 2
Alias Symbols DDC8, CSC-21K
Peptide Sequence Synthetic peptide located within the following region: NADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
Protein Interactions BAG3; ITGA3; MMP14; ITGB1; MMP2; MMP8; SNCG; PSMA7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TIMP2 (ARP59180_P050) antibody
Blocking Peptide For anti-TIMP2 (ARP59180_P050) antibody is Catalog # AAP59180 (Previous Catalog # AAPP45148)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP2
Uniprot ID P16035
Protein Name Metalloproteinase inhibitor 2
Protein Accession # NP_003246
Purification Affinity Purified
Nucleotide Accession # NM_003255
Tested Species Reactivity Human
Gene Symbol TIMP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 79%
Image 1
Human Placenta
WB Suggested Anti-TIMP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Image 2
Human Ovarian Cancer Tissue
TIMP2 in human ovarian cancer was detected using HRP/AEC red color stain.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com