Product Number |
ARP59180_P050 |
Product Page |
www.avivasysbio.com/timp2-antibody-n-terminal-region-arp59180-p050.html |
Name |
TIMP2 Antibody - N-terminal region (ARP59180_P050) |
Protein Size (# AA) |
220 amino acids |
Molecular Weight |
22kDa |
NCBI Gene Id |
7077 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
TIMP metallopeptidase inhibitor 2 |
Alias Symbols |
DDC8, CSC-21K |
Peptide Sequence |
Synthetic peptide located within the following region: NADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. |
Protein Interactions |
BAG3; ITGA3; MMP14; ITGB1; MMP2; MMP8; SNCG; PSMA7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TIMP2 (ARP59180_P050) antibody |
Blocking Peptide |
For anti-TIMP2 (ARP59180_P050) antibody is Catalog # AAP59180 (Previous Catalog # AAPP45148) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP2 |
Uniprot ID |
P16035 |
Protein Name |
Metalloproteinase inhibitor 2 |
Protein Accession # |
NP_003246 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003255 |
Tested Species Reactivity |
Human |
Gene Symbol |
TIMP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 79% |
Image 1 | Human Placenta
| WB Suggested Anti-TIMP2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta |
| Image 2 | Human Ovarian Cancer Tissue
| TIMP2 in human ovarian cancer was detected using HRP/AEC red color stain. |
|
|