| Product Number |
ARP58992_P050 |
| Product Page |
www.avivasysbio.com/casp5-antibody-middle-region-arp58992-p050.html |
| Name |
CASP5 Antibody - middle region (ARP58992_P050) |
| Protein Size (# AA) |
376 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
838 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Caspase 5, apoptosis-related cysteine peptidase |
| Alias Symbols |
ICH-3, ICEREL-III, ICE(rel)III |
| Peptide Sequence |
Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. |
| Protein Interactions |
PPHLN1; NLRP1; CASP5; MAX; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CASP5 (ARP58992_P050) antibody |
| Blocking Peptide |
For anti-CASP5 (ARP58992_P050) antibody is Catalog # AAP58992 (Previous Catalog # AAPP44959) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CASP5 |
| Uniprot ID |
P51878 |
| Protein Name |
Caspase-5 |
| Protein Accession # |
NP_001129581 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001136109 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CASP5 |
| Predicted Species Reactivity |
Human, Cow, Guinea Pig |
| Application |
WB, FC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Guinea Pig: 82%; Human: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-CASP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: A549 cell lysate |
|
|
