CASP1 Antibody - middle region (ARP58983_P050)

Data Sheet
 
Product Number ARP58983_P050
Product Page www.avivasysbio.com/casp1-antibody-middle-region-arp58983-p050.html
Name CASP1 Antibody - middle region (ARP58983_P050)
Protein Size (# AA) 383 amino acids
Molecular Weight 10kDa
NCBI Gene Id 834
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Caspase 1, apoptosis-related cysteine peptidase
Description
Alias Symbols ICE, P45, IL1BC
Peptide Sequence Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.
Protein Interactions ced-3; ced-4; VAC14; BCL2L1; UBC; XK; PLA2G4B; IL33; IL1B; PARP1; BIRC3; TRAF2; CEBPB; TIRAP; CARD17; CARD16; CARD8; PLA2G4A; CDK11B; NLRP1; ATN1; ATXN3; PYCARD; NLRC4; NOD1; CASP14; RIPK2; PAK1; PARK2; NEDD4; BID; IL18; PSEN2; NFE2L2; AR; BCAP31; MAPT; L
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CASP1 (ARP58983_P050) antibody
Blocking Peptide For anti-CASP1 (ARP58983_P050) antibody is Catalog # AAP58983 (Previous Catalog # AAPP44950)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CASP1
Uniprot ID P29466
Protein Name Caspase-1
Sample Type Confirmation

CASP1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_001214
Purification Affinity Purified
Nucleotide Accession # NM_001223
Tested Species Reactivity Human
Gene Symbol CASP1
Predicted Species Reactivity Human, Horse, Rabbit, Yeast
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%; Rabbit: 79%; Yeast: 100%
Image 1
Human 721_B
WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateCASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 2
Human Lymph Node
Rabbit Anti-CASP1 Antibody
Catalog Number: ARP58983_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com