| Product Number |
ARP58951_P050 |
| Product Page |
www.avivasysbio.com/snag1-antibody-middle-region-arp58951-p050.html |
| Name |
SNAG1 Antibody - middle region (ARP58951_P050) |
| Protein Size (# AA) |
624 amino acids |
| Molecular Weight |
69kDa |
| NCBI Gene Id |
112574 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sorting nexin 18 |
| Alias Symbols |
SNAG1, SH3PX2, SH3PXD3B |
| Peptide Sequence |
Synthetic peptide located within the following region: QCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
ANKRD28; GRB2; CBL; CUL1; FASLG; UBC; ITCH; SOS2; SOS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNX18 (ARP58951_P050) antibody |
| Blocking Peptide |
For anti-SNX18 (ARP58951_P050) antibody is Catalog # AAP58951 (Previous Catalog # AAPP44923) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNAG1 |
| Uniprot ID |
Q96RF0-2 |
| Protein Name |
Sorting nexin-18 |
| Protein Accession # |
NP_001096045 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001102575 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNX18 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-SNAG1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: A549 cell lysate |
|
|
