| Product Number |
ARP58940_P050 |
| Product Page |
www.avivasysbio.com/psen2-antibody-c-terminal-region-arp58940-p050.html |
| Name |
PSEN2 Antibody - C-terminal region (ARP58940_P050) |
| Protein Size (# AA) |
304 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
5664 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
presenilin 2 |
| Alias Symbols |
AD4, PS2, AD3L, STM2, CMD1V |
| Peptide Sequence |
Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PSEN2 (ARP58940_P050) antibody |
| Blocking Peptide |
For anti-PSEN2 (ARP58940_P050) antibody is Catalog # AAP58940 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human PSEN2 |
| Uniprot ID |
E5RG63 |
| Protein Name |
presenilin-2 |
| Protein Accession # |
XP_011542538.1 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_011544236.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PSEN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 100% |
| Image 1 | Human Fetal Lung
 | Host: Rabbit
Target Name: PSEN2
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml |
|
|
