Product Number |
ARP58842_P050 |
Product Page |
www.avivasysbio.com/jarid2-antibody-n-terminal-region-arp58842-p050.html |
Name |
JARID2 Antibody - N-terminal region (ARP58842_P050) |
Protein Size (# AA) |
1246 amino acids |
Molecular Weight |
139kDa |
NCBI Gene Id |
3720 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Jumonji, AT rich interactive domain 2 |
Alias Symbols |
JMJ |
Peptide Sequence |
Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
Description of Target |
This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a |
Protein Interactions |
SUZ12; EZH2; GATA4; NKX2-5; ALB; ELAVL1; SETDB1; MTF2; EHMT1; EHMT2; NPPA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-JARID2 (ARP58842_P050) antibody |
Blocking Peptide |
For anti-JARID2 (ARP58842_P050) antibody is Catalog # AAP58842 (Previous Catalog # AAPP39648) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2 |
Uniprot ID |
Q92833 |
Protein Name |
Protein Jumonji |
Sample Type Confirmation |
JARID2 is strongly supported by BioGPS gene expression data to be expressed in 721_B JARID2 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_004964 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017566 |
Tested Species Reactivity |
Human |
Gene Symbol |
JARID2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-JARID2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysateJARID2 is supported by BioGPS gene expression data to be expressed in HeLa |
|
Image 2 | Human 721_B
| Host: Rabbit Target Name: JARID2 Sample Type: 721_B Antibody Dilution: 1.0ug/mlJARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|