JARID2 Antibody - N-terminal region (ARP58842_P050)

Data Sheet
 
Product Number ARP58842_P050
Product Page www.avivasysbio.com/jarid2-antibody-n-terminal-region-arp58842-p050.html
Name JARID2 Antibody - N-terminal region (ARP58842_P050)
Protein Size (# AA) 1246 amino acids
Molecular Weight 139kDa
NCBI Gene Id 3720
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Jumonji, AT rich interactive domain 2
Alias Symbols JMJ
Peptide Sequence Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Protein Interactions SUZ12; EZH2; GATA4; NKX2-5; ALB; ELAVL1; SETDB1; MTF2; EHMT1; EHMT2; NPPA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JARID2 (ARP58842_P050) antibody
Blocking Peptide For anti-JARID2 (ARP58842_P050) antibody is Catalog # AAP58842 (Previous Catalog # AAPP39648)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2
Uniprot ID Q92833
Protein Name Protein Jumonji
Sample Type Confirmation

JARID2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

JARID2 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_004964
Purification Affinity Purified
Nucleotide Accession # NM_017566
Tested Species Reactivity Human
Gene Symbol JARID2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-JARID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysateJARID2 is supported by BioGPS gene expression data to be expressed in HeLa
Image 2
Human 721_B
Host: Rabbit
Target Name: JARID2
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlJARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com