Product Number |
ARP58823_P050 |
Product Page |
www.avivasysbio.com/nrbp2-antibody-middle-region-arp58823-p050.html |
Name |
NRBP2 Antibody - middle region (ARP58823_P050) |
Protein Size (# AA) |
258 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
340371 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nuclear receptor binding protein 2 |
Alias Symbols |
TRG16, pp9320 |
Peptide Sequence |
Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729 |
Description of Target |
The specific function of this protein remains unknown. |
Protein Interactions |
TSC22D4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NRBP2 (ARP58823_P050) antibody |
Blocking Peptide |
For anti-NRBP2 (ARP58823_P050) antibody is Catalog # AAP58823 (Previous Catalog # AAPP38641) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NRBP2 |
Uniprot ID |
Q9NSY0 |
Protein Name |
Nuclear receptor-binding protein 2 |
Protein Accession # |
NP_848659 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_178564 |
Tested Species Reactivity |
Human |
Gene Symbol |
NRBP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human Placenta
| WB Suggested Anti-NRBP2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta |
|
|