NRBP2 Antibody - middle region (ARP58823_P050)

Data Sheet
 
Product Number ARP58823_P050
Product Page www.avivasysbio.com/nrbp2-antibody-middle-region-arp58823-p050.html
Name NRBP2 Antibody - middle region (ARP58823_P050)
Protein Size (# AA) 258 amino acids
Molecular Weight 30kDa
NCBI Gene Id 340371
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor binding protein 2
Alias Symbols TRG16, pp9320
Peptide Sequence Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729
Description of Target The specific function of this protein remains unknown.
Protein Interactions TSC22D4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NRBP2 (ARP58823_P050) antibody
Blocking Peptide For anti-NRBP2 (ARP58823_P050) antibody is Catalog # AAP58823 (Previous Catalog # AAPP38641)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NRBP2
Uniprot ID Q9NSY0
Protein Name Nuclear receptor-binding protein 2
Protein Accession # NP_848659
Purification Affinity Purified
Nucleotide Accession # NM_178564
Tested Species Reactivity Human
Gene Symbol NRBP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-NRBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com