| Product Number |
ARP58820_P050 |
| Product Page |
www.avivasysbio.com/rasgrp2-antibody-n-terminal-region-arp58820-p050.html |
| Name |
RASGRP2 Antibody - N-terminal region (ARP58820_P050) |
| Protein Size (# AA) |
609 amino acids |
| Molecular Weight |
69kDa |
| NCBI Gene Id |
10235 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RAS guanyl releasing protein 2 (calcium and DAG-regulated) |
| Alias Symbols |
CDC25L, CALDAG-GEFI |
| Peptide Sequence |
Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katagiri,K., (2004) J. Biol. Chem. 279 (12), 11875-11881 |
| Description of Target |
The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act |
| Protein Interactions |
UBC; APP; PTCHD2; FAM118B; KRAS; RAP1A; NRAS; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RASGRP2 (ARP58820_P050) antibody |
| Blocking Peptide |
For anti-RASGRP2 (ARP58820_P050) antibody is Catalog # AAP58820 (Previous Catalog # AAPP38638) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRP2 |
| Uniprot ID |
Q7LDG7 |
| Protein Name |
RAS guanyl-releasing protein 2 |
| Protein Accession # |
NP_722541 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153819 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RASGRP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-RASGRP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
|
