Product Number |
ARP58814_P050 |
Product Page |
https://www.avivasysbio.com/pdgfd-antibody-n-terminal-region-arp58814-p050.html |
Name |
PDGFD Antibody - N-terminal region (ARP58814_P050) |
Protein Size (# AA) |
370 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
80310 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Platelet derived growth factor D |
Alias Symbols |
IEGF, SCDGFB, MSTP036, SCDGF-B |
Peptide Sequence |
Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Liu,G., (2008) Hum. Pathol. 39 (3), 393-402 |
Description of Target |
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f |
Protein Interactions |
UBC; PDGFRB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PDGFD (ARP58814_P050) antibody |
Blocking Peptide |
For anti-PDGFD (ARP58814_P050) antibody is Catalog # AAP58814 (Previous Catalog # AAPP38632) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFD |
Uniprot ID |
Q9GZP0 |
Protein Name |
Platelet-derived growth factor D |
Protein Accession # |
NP_079484 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025208 |
Tested Species Reactivity |
Human |
Gene Symbol |
PDGFD |
Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Heart
 | WB Suggested Anti-PDGFD Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
|
|