PDGFD Antibody - N-terminal region (ARP58814_P050)

Data Sheet
 
Product Number ARP58814_P050
Product Page https://www.avivasysbio.com/pdgfd-antibody-n-terminal-region-arp58814-p050.html
Name PDGFD Antibody - N-terminal region (ARP58814_P050)
Protein Size (# AA) 370 amino acids
Molecular Weight 40kDa
NCBI Gene Id 80310
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Platelet derived growth factor D
Alias Symbols IEGF, SCDGFB, MSTP036, SCDGF-B
Peptide Sequence Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Liu,G., (2008) Hum. Pathol. 39 (3), 393-402
Description of Target The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
Protein Interactions UBC; PDGFRB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PDGFD (ARP58814_P050) antibody
Blocking Peptide For anti-PDGFD (ARP58814_P050) antibody is Catalog # AAP58814 (Previous Catalog # AAPP38632)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFD
Uniprot ID Q9GZP0
Protein Name Platelet-derived growth factor D
Protein Accession # NP_079484
Purification Affinity Purified
Nucleotide Accession # NM_025208
Tested Species Reactivity Human
Gene Symbol PDGFD
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Image 1
Human Heart
WB Suggested Anti-PDGFD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart