Product Number |
ARP58810_P050 |
Product Page |
https://www.avivasysbio.com/prkrip1-antibody-n-terminal-region-arp58810-p050.html |
Name |
PRKRIP1 Antibody - N-terminal region (ARP58810_P050) |
Protein Size (# AA) |
184 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
79706 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
PRKR interacting protein 1 (IL11 inducible) |
Alias Symbols |
C114, KRBOX3 |
Peptide Sequence |
Synthetic peptide located within the following region: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yin,Z., (2003) J. Biol. Chem. 278 (25), 22838-22845 |
Description of Target |
PRKRIP1 binds double-stranded RNA.It inhibits EIF2AK2 kinase activity. |
Protein Interactions |
CEP70; TRAF2; UBC; APP; MAGEA11; EIF2AK2; RNU11; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PRKRIP1 (ARP58810_P050) antibody |
Blocking Peptide |
For anti-PRKRIP1 (ARP58810_P050) antibody is Catalog # AAP58810 (Previous Catalog # AAPP38628) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIP1 |
Uniprot ID |
Q9H875 |
Protein Name |
PRKR-interacting protein 1 |
Protein Accession # |
NP_078929 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024653 |
Tested Species Reactivity |
Human |
Gene Symbol |
PRKRIP1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human COLO205
 | WB Suggested Anti-PRKRIP1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: COLO205 cell lysate |
|
|