PRKRIP1 Antibody - N-terminal region (ARP58810_P050)

• Name: PRKRIP1 Antibody - N-terminal region (ARP58810_P050)
• Protein Size (# AA): 184 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 79706
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: PRKR interacting protein 1 (IL11 inducible)
• Alias Symbols: C114, KRBOX3
• Peptide Sequence: Synthetic peptide located within the following region: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yin,Z., (2003) J. Biol. Chem. 278 (25), 22838-22845
• Description of Target: PRKRIP1 binds double-stranded RNA.It inhibits EIF2AK2 kinase activity.
• Protein Interactions: CEP70; TRAF2; UBC; APP; MAGEA11; EIF2AK2; RNU11;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRKRIP1 (ARP58810_P050) antibody is Catalog # AAP58810 (Previous Catalog # AAPP38628)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIP1
• Uniprot ID: Q9H875
• Protein Name: PRKR-interacting protein 1
• Protein Accession #: NP_078929
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024653
• Tested Species Reactivity: Human
• Gene Symbol: PRKRIP1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human COLO205
  
  WB Suggested Anti-PRKRIP1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: COLO205 cell lysate