Product Number |
ARP58799_P050 |
Product Page |
www.avivasysbio.com/gnl3l-antibody-n-terminal-region-arp58799-p050.html |
Name |
GNL3L Antibody - N-terminal region (ARP58799_P050) |
Protein Size (# AA) |
582 amino acids |
Molecular Weight |
66 kDa |
NCBI Gene Id |
54552 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Guanine nucleotide binding protein-like 3 (nucleolar)-like |
Alias Symbols |
GNL3B |
Peptide Sequence |
Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654 |
Description of Target |
GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation. |
Protein Interactions |
LZTS2; ROPN1; ALAS1; ADRB2; UBC; UBD; SLC2A4; ELAVL1; TERT; TERF1; TP53; MDM2; LDOC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-GNL3L (ARP58799_P050) antibody |
Blocking Peptide |
For anti-GNL3L (ARP58799_P050) antibody is Catalog # AAP58799 (Previous Catalog # AAPP38617) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L |
Uniprot ID |
Q9NVN8 |
Protein Name |
Guanine nucleotide-binding protein-like 3-like protein |
Sample Type Confirmation |
GNL3L is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_061940 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_019067 |
Tested Species Reactivity |
Human |
Gene Symbol |
GNL3L |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IF, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 86%; Rat: 86% |
Image 1 | Human Lung
| WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung |
|
Image 2 | Human 721_B
| Host: Rabbit Target Name: GNL3L Sample Type: 721_B Antibody Dilution: 1.0ug/mlGNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|
Image 3 | HeLa
| Sample Type: HeLa Primary Antibody Dilution: 4 ug/ml Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml Gene Name: GNL3L |
|