GNL3L Antibody - N-terminal region (ARP58799_P050)

Data Sheet
 
Product Number ARP58799_P050
Product Page www.avivasysbio.com/gnl3l-antibody-n-terminal-region-arp58799-p050.html
Name GNL3L Antibody - N-terminal region (ARP58799_P050)
Protein Size (# AA) 582 amino acids
Molecular Weight 66 kDa
NCBI Gene Id 54552
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Guanine nucleotide binding protein-like 3 (nucleolar)-like
Alias Symbols GNL3B
Peptide Sequence Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654
Description of Target GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Protein Interactions LZTS2; ROPN1; ALAS1; ADRB2; UBC; UBD; SLC2A4; ELAVL1; TERT; TERF1; TP53; MDM2; LDOC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-GNL3L (ARP58799_P050) antibody
Blocking Peptide For anti-GNL3L (ARP58799_P050) antibody is Catalog # AAP58799 (Previous Catalog # AAPP38617)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
Uniprot ID Q9NVN8
Protein Name Guanine nucleotide-binding protein-like 3-like protein
Sample Type Confirmation

GNL3L is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_061940
Purification Affinity Purified
Nucleotide Accession # NM_019067
Tested Species Reactivity Human
Gene Symbol GNL3L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 86%; Rat: 86%
Image 1
Human Lung
WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
Image 2
Human 721_B
Host: Rabbit
Target Name: GNL3L
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlGNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 3
HeLa
Sample Type:
HeLa
Primary Antibody Dilution:
4 ug/ml
Secondary Antibody:
Anti-rabbit Alexa 546
Secondary Antibody Dilution:
2 ug/ml
Gene Name:
GNL3L
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com