GNL3L Antibody - N-terminal region (ARP58798_P050)

Data Sheet
 
Product Number ARP58798_P050
Product Page www.avivasysbio.com/gnl3l-antibody-n-terminal-region-arp58798-p050.html
Name GNL3L Antibody - N-terminal region (ARP58798_P050)
Protein Size (# AA) 582 amino acids
Molecular Weight 65kDa
NCBI Gene Id 54552
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Guanine nucleotide binding protein-like 3 (nucleolar)-like
Alias Symbols GNL3B
Peptide Sequence Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654
Description of Target GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Protein Interactions LZTS2; ROPN1; ALAS1; ADRB2; UBC; UBD; SLC2A4; ELAVL1; TERT; TERF1; TP53; MDM2; LDOC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GNL3L (ARP58798_P050) antibody
Blocking Peptide For anti-GNL3L (ARP58798_P050) antibody is Catalog # AAP58798 (Previous Catalog # AAPP38616)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
Uniprot ID Q9NVN8
Protein Name Guanine nucleotide-binding protein-like 3-like protein
Protein Accession # NP_061940
Purification Affinity Purified
Nucleotide Accession # NM_019067
Tested Species Reactivity Human
Gene Symbol GNL3L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human Adult Liver
Rabbit Anti-GNL3L Antibody
Catalog Number: ARP58798_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Nuclear in hepatocytes, moderate signal, low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 2
Human Lung
WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com