PDAP1 Antibody - N-terminal region (ARP58790_P050)

Data Sheet
 
Product Number ARP58790_P050
Product Page www.avivasysbio.com/pdap1-antibody-n-terminal-region-arp58790-p050.html
Name PDAP1 Antibody - N-terminal region (ARP58790_P050)
Protein Size (# AA) 181 amino acids
Molecular Weight 20kDa
NCBI Gene Id 11333
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PDGFA associated protein 1
Alias Symbols PAP, PAP1, HASPP28
Peptide Sequence Synthetic peptide located within the following region: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
Protein Interactions HUWE1; UBC; LMNA; FN1; CSNK2A1; APP; PDGFB; PDGFA; PDGFRB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PDAP1 (ARP58790_P050) antibody
Blocking Peptide For anti-PDAP1 (ARP58790_P050) antibody is Catalog # AAP58790 (Previous Catalog # AAPP38608)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDAP1
Uniprot ID Q13442
Protein Name 28 kDa heat- and acid-stable phosphoprotein
Protein Accession # NP_055706
Purification Affinity Purified
Nucleotide Accession # NM_014891
Tested Species Reactivity Human
Gene Symbol PDAP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Image 1
Human HeLa
WB Suggested Anti-PDAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com