| Product Number |
ARP58780_P050 |
| Product Page |
www.avivasysbio.com/sipa1-antibody-middle-region-arp58780-p050.html |
| Name |
SIPA1 Antibody - middle region (ARP58780_P050) |
| Protein Size (# AA) |
1042 amino acids |
| Molecular Weight |
112kDa |
| NCBI Gene Id |
6494 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Signal-induced proliferation-associated 1 |
| Alias Symbols |
SPA1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lee,Y.J., (2008) Int. J. Dev. Biol. 52 (1), 43-53 |
| Description of Target |
The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell |
| Protein Interactions |
FN1; DVL1; CDKN1A; FMNL1; RFWD2; BRD4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SIPA1 (ARP58780_P050) antibody |
| Blocking Peptide |
For anti-SIPA1 (ARP58780_P050) antibody is Catalog # AAP58780 (Previous Catalog # AAPP38546) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SIPA1 |
| Uniprot ID |
Q96FS4 |
| Protein Name |
Signal-induced proliferation-associated protein 1 |
| Protein Accession # |
NP_006738 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006747 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SIPA1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HT1080
 | WB Suggested Anti-SIPA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate |
|
|
