SIPA1 Antibody - middle region (ARP58780_P050)

Data Sheet
 
Product Number ARP58780_P050
Product Page www.avivasysbio.com/sipa1-antibody-middle-region-arp58780-p050.html
Name SIPA1 Antibody - middle region (ARP58780_P050)
Protein Size (# AA) 1042 amino acids
Molecular Weight 112kDa
NCBI Gene Id 6494
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Signal-induced proliferation-associated 1
Alias Symbols SPA1
Peptide Sequence Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,Y.J., (2008) Int. J. Dev. Biol. 52 (1), 43-53
Description of Target The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell
Protein Interactions FN1; DVL1; CDKN1A; FMNL1; RFWD2; BRD4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIPA1 (ARP58780_P050) antibody
Blocking Peptide For anti-SIPA1 (ARP58780_P050) antibody is Catalog # AAP58780 (Previous Catalog # AAPP38546)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SIPA1
Uniprot ID Q96FS4
Protein Name Signal-induced proliferation-associated protein 1
Protein Accession # NP_006738
Purification Affinity Purified
Nucleotide Accession # NM_006747
Tested Species Reactivity Human
Gene Symbol SIPA1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HT1080
WB Suggested Anti-SIPA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com