| Product Number |
ARP58779_P050 |
| Product Page |
www.avivasysbio.com/nes-antibody-middle-region-arp58779-p050.html |
| Name |
NES Antibody - middle region (ARP58779_P050) |
| Protein Size (# AA) |
1621 amino acids |
| Molecular Weight |
177kDa |
| NCBI Gene Id |
10763 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nestin |
| Alias Symbols |
Nbla00170 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Scobioala,S., (2008) FASEB J. 22 (4), 1021-1031 |
| Description of Target |
Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu |
| Protein Interactions |
SUMO3; UBC; SIRT7; CDK5R1; CDK5; SRRM1; CDK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NES (ARP58779_P050) antibody |
| Additional Information |
IHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 2.5 ug/ml. |
| Blocking Peptide |
For anti-NES (ARP58779_P050) antibody is Catalog # AAP58779 (Previous Catalog # AAPP38545) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NES |
| Uniprot ID |
P48681 |
| Protein Name |
Nestin |
| Protein Accession # |
NP_006608 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006617 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
NES |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 86% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate |
|
| Image 2 | Human Heart
 | Heart |
|
| Image 3 | mouse NIH3T3, stem
 | WB Suggested Anti-NES Antibody
Positive Control: Lane1: 25ug mouse NIH3T3 lysate, Lane2: 25ug mouse embryonic stem cell lysate, Lane3: 25ug mouse neural stem cell lysate
Primary Antibody Dilution : 1:500
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:3000
Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS |
|
| Image 4 | Human OVCAR-3 Whole Cell
 | Host: Rabbit
Target Name: NES
Sample Tissue: Human OVCAR-3 Whole Cell
Antibody Dilution: 1ug/ml |
|
