Product Number |
ARP58771_P050 |
Product Page |
www.avivasysbio.com/gmfg-antibody-middle-region-arp58771-p050.html |
Name |
GMFG Antibody - middle region (ARP58771_P050) |
Protein Size (# AA) |
142 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
9535 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glia maturation factor, gamma |
Alias Symbols |
GMF-GAMMA |
Peptide Sequence |
Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shi,Y., (2006) Genomics Proteomics Bioinformatics 4 (3), 145-155 |
Description of Target |
The specific function of this protein remains unknown. |
Protein Interactions |
UBC; VANGL1; CAMK1D; PSD; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GMFG (ARP58771_P050) antibody |
Blocking Peptide |
For anti-GMFG (ARP58771_P050) antibody is Catalog # AAP58771 (Previous Catalog # AAPP38537) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GMFG |
Uniprot ID |
O60234 |
Protein Name |
Glia maturation factor gamma |
Protein Accession # |
NP_004868 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004877 |
Tested Species Reactivity |
Human |
Gene Symbol |
GMFG |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Thymus
| WB Suggested Anti-GMFG Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Thymus |
|
|