| Product Number |
ARP58771_P050 |
| Product Page |
www.avivasysbio.com/gmfg-antibody-middle-region-arp58771-p050.html |
| Name |
GMFG Antibody - middle region (ARP58771_P050) |
| Protein Size (# AA) |
142 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
9535 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glia maturation factor, gamma |
| Alias Symbols |
GMF-GAMMA |
| Peptide Sequence |
Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shi,Y., (2006) Genomics Proteomics Bioinformatics 4 (3), 145-155 |
| Description of Target |
The specific function of this protein remains unknown. |
| Protein Interactions |
UBC; VANGL1; CAMK1D; PSD; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GMFG (ARP58771_P050) antibody |
| Blocking Peptide |
For anti-GMFG (ARP58771_P050) antibody is Catalog # AAP58771 (Previous Catalog # AAPP38537) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GMFG |
| Uniprot ID |
O60234 |
| Protein Name |
Glia maturation factor gamma |
| Protein Accession # |
NP_004868 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004877 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GMFG |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Thymus
 | WB Suggested Anti-GMFG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus |
|
|
