GMFG Antibody - middle region (ARP58771_P050)

Data Sheet
 
Product Number ARP58771_P050
Product Page www.avivasysbio.com/gmfg-antibody-middle-region-arp58771-p050.html
Name GMFG Antibody - middle region (ARP58771_P050)
Protein Size (# AA) 142 amino acids
Molecular Weight 17kDa
NCBI Gene Id 9535
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glia maturation factor, gamma
Alias Symbols GMF-GAMMA
Peptide Sequence Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shi,Y., (2006) Genomics Proteomics Bioinformatics 4 (3), 145-155
Description of Target The specific function of this protein remains unknown.
Protein Interactions UBC; VANGL1; CAMK1D; PSD;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GMFG (ARP58771_P050) antibody
Blocking Peptide For anti-GMFG (ARP58771_P050) antibody is Catalog # AAP58771 (Previous Catalog # AAPP38537)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GMFG
Uniprot ID O60234
Protein Name Glia maturation factor gamma
Protein Accession # NP_004868
Purification Affinity Purified
Nucleotide Accession # NM_004877
Tested Species Reactivity Human
Gene Symbol GMFG
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Image 1
Human Thymus
WB Suggested Anti-GMFG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com