KRT75 Antibody - N-terminal region (ARP58768_P050)

Data Sheet
 
Product Number ARP58768_P050
Product Page www.avivasysbio.com/krt75-antibody-n-terminal-region-arp58768-p050.html
Name KRT75 Antibody - N-terminal region (ARP58768_P050)
Protein Size (# AA) 551 amino acids
Molecular Weight 59kDa
NCBI Gene Id 9119
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Keratin 75
Alias Symbols K75, PFB, K6HF, KB18, CK-75, hK6hf
Peptide Sequence Synthetic peptide located within the following region: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Schweizer,J., (2006) J. Cell Biol. 174 (2), 169-174
Description of Target This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion
Protein Interactions LGR4; WWOX; UBC; EIF4A3; EPS15; CAND1; DCUN1D1; COPS5; COPS6; CUL1; CUL2; CUL3; CUL4A; CUL4B; CUL5; NEDD8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KRT75 (ARP58768_P050) antibody
Blocking Peptide For anti-KRT75 (ARP58768_P050) antibody is Catalog # AAP58768 (Previous Catalog # AAPP38744)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KRT75
Uniprot ID O95678
Protein Name Keratin, type II cytoskeletal 75
Protein Accession # NP_004684
Purification Affinity Purified
Nucleotide Accession # NM_004693
Tested Species Reactivity Human
Gene Symbol KRT75
Predicted Species Reactivity Human, Mouse, Rat, Cow, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 79%; Rat: 93%
Image 1
Human HT1080
WB Suggested Anti-KRT75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com