| Product Number |
ARP58766_P050-Biotin |
| Product Page |
www.avivasysbio.com/slit3-antibody-n-terminal-region-biotin-arp58766-p050-biotin.html |
| Name |
SLIT3 Antibody - N-terminal region : Biotin (ARP58766_P050-Biotin) |
| Protein Size (# AA) |
1523 amino acids |
| Molecular Weight |
168kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
6586 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Slit homolog 3 (Drosophila) |
| Alias Symbols |
MEGF5, SLIL2, SLIT1, slit2, Slit-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Lin,L. (2006) Stem Cells 24 (11), 2504-2513 |
| Description of Target |
SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors. |
| Protein Interactions |
CAPN1; ROBO2; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SLIT3 (ARP58766_P050-Biotin) antibody |
| Blocking Peptide |
For anti-SLIT3 (ARP58766_P050-Biotin) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3 |
| Uniprot ID |
O75094 |
| Protein Name |
Slit homolog 3 protein |
| Protein Accession # |
NP_003053 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003062 |
| Gene Symbol |
SLIT3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | |
|
