SLIT3 Antibody - N-terminal region (ARP58766_P050)

• Product Number: ARP58766_P050
• Name: SLIT3 Antibody - N-terminal region (ARP58766_P050)
• Protein Size (# AA): 1523 amino acids
• Molecular Weight: 168 kDa
• NCBI Gene Id: 6586
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Slit homolog 3 (Drosophila)
• Alias Symbols: MEGF5, SLIL2, SLIT1, slit2, Slit-3
• Peptide Sequence: Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lin,L. (2006) Stem Cells 24 (11), 2504-2513
• Description of Target: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
• Protein Interactions: CAPN1; ROBO2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-SLIT3 (ARP58766_P050) antibody is Catalog # AAP58766 (Previous Catalog # AAPP38647)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3
• Uniprot ID: O75094
• Protein Name: Slit homolog 3 protein
• Protein Accession #: NP_003053
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003062
• Tested Species Reactivity: Human
• Gene Symbol: SLIT3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Jurkat
  
  Host: Rabbit
  Target Name: SLIT3
  Sample Type: Jurkat Cell lysates
  Antibody Dilution: 1.0ug/ml
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.