| Product Number |
ARP58765_P050-FITC |
| Product Page |
www.avivasysbio.com/slit1-antibody-middle-region-fitc-arp58765-p050-fitc.html |
| Name |
SLIT1 Antibody - middle region : FITC (ARP58765_P050-FITC) |
| Protein Size (# AA) |
1534 amino acids |
| Molecular Weight |
168kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
6585 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Slit homolog 1 (Drosophila) |
| Alias Symbols |
MEGF4, SLIL1, SLIT3, SLIT-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698 |
| Description of Target |
SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub |
| Protein Interactions |
ATN1; ROBO1; GPC1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SLIT1 (ARP58765_P050-FITC) antibody |
| Blocking Peptide |
For anti-SLIT1 (ARP58765_P050-FITC) antibody is Catalog # AAP58765 (Previous Catalog # AAPP38532) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLIT1 |
| Uniprot ID |
O75093 |
| Protein Name |
Slit homolog 1 protein |
| Protein Accession # |
NP_003052 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003061 |
| Gene Symbol |
SLIT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86% |
| Image 1 | |
|
