| Product Number |
ARP58765_P050 |
| Product Page |
www.avivasysbio.com/slit1-antibody-middle-region-arp58765-p050.html |
| Name |
SLIT1 Antibody - middle region (ARP58765_P050) |
| Protein Size (# AA) |
1534 amino acids |
| Molecular Weight |
168kDa |
| NCBI Gene Id |
6585 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Slit homolog 1 (Drosophila) |
| Alias Symbols |
MEGF4, SLIL1, SLIT3, SLIT-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698 |
| Description of Target |
SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub |
| Protein Interactions |
ATN1; ROBO1; GPC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLIT1 (ARP58765_P050) antibody |
| Blocking Peptide |
For anti-SLIT1 (ARP58765_P050) antibody is Catalog # AAP58765 (Previous Catalog # AAPP38532) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLIT1 |
| Uniprot ID |
O75093 |
| Protein Name |
Slit homolog 1 protein |
| Protein Accession # |
NP_003052 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003061 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
SLIT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86% |
| Image 1 | Human Stomach
 | WB Suggested Anti-SLIT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach |
| | Image 2 | Mouse Gut tissue
 | Immunohistochemistry with SLIT1 GFP/ WT mouse gut tissue at an antibody concentration of 2.5 ug/ml using anti-SLIT1 antibody (ARP58765_P050) |
|
|
