SHB Antibody - N-terminal region (ARP58763_P050)

Data Sheet
 
Product Number ARP58763_P050
Product Page www.avivasysbio.com/shb-antibody-n-terminal-region-arp58763-p050.html
Name SHB Antibody - N-terminal region (ARP58763_P050)
Protein Size (# AA) 509 amino acids
Molecular Weight 55kDa
NCBI Gene Id 6461
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Src homology 2 domain containing adaptor protein B
Alias Symbols bA3J10.2
Peptide Sequence Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491
Description of Target SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Protein Interactions SLC39A1; GRAP2; LAT; LCP2; EPS8; JAK3; IL2RG; KDR; SRC; ZAP70; PDGFRA; PLCG1; PIK3R1; VAV1; CRK; JAK1; IL2RB; GRB2; FGFR1; PDGFRB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SHB (ARP58763_P050) antibody
Blocking Peptide For anti-SHB (ARP58763_P050) antibody is Catalog # AAP58763 (Previous Catalog # AAPP38530)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SHB
Uniprot ID Q15464
Protein Name SH2 domain-containing adapter protein B
Sample Type Confirmation

SHB is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_003019
Purification Affinity Purified
Nucleotide Accession # NM_003028
Tested Species Reactivity Human
Gene Symbol SHB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-SHB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateSHB is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com