SHB Antibody - N-terminal region (ARP58762_P050)

• Product Number: ARP58762_P050
• Name: SHB Antibody - N-terminal region (ARP58762_P050)
• Protein Size (# AA): 509 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 6461
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Src homology 2 domain containing adaptor protein B
• Alias Symbols: bA3J10.2
• Peptide Sequence: Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491
• Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a rol
• Protein Interactions: SLC39A1; GRAP2; LAT; LCP2; EPS8; JAK3; IL2RG; KDR; SRC; ZAP70; PDGFRA; PLCG1; PIK3R1; VAV1; CRK; JAK1; IL2RB; GRB2; FGFR1; PDGFRB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SHB (ARP58762_P050) antibody is Catalog # AAP58762 (Previous Catalog # AAPP38529)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB
• Uniprot ID: Q15464
• Protein Name: SH2 domain-containing adapter protein B
• Sample Type Confirmation:

  SHB is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_003019
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003028
• Tested Species Reactivity: Human
• Gene Symbol: SHB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
• Image 1: Human HepG2
  
  WB Suggested Anti-SHB Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysateSHB is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Liver
  
  Rabbit Anti-SHB antibody
  Catalog Number: ARP58762
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec