Product Number |
ARP58757_P050 |
Product Page |
www.avivasysbio.com/bmp6-antibody-middle-region-arp58757-p050.html |
Name |
BMP6 Antibody - middle region (ARP58757_P050) |
Protein Size (# AA) |
513 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
654 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Bone morphogenetic protein 6 |
Alias Symbols |
VGR, VGR1 |
Peptide Sequence |
Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Klink,A., (2008) Blood 111 (12), 5721-5726 |
Description of Target |
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of deminer |
Protein Interactions |
UBC; BMPER; SOSTDC1; CHRDL2; BMPR1B; SMAD5; NCOA3; BMPR1A; BMPR2; ACVR2A; ACVR2B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BMP6 (ARP58757_P050) antibody |
Blocking Peptide |
For anti-BMP6 (ARP58757_P050) antibody is Catalog # AAP58757 (Previous Catalog # AAPP38524) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BMP6 |
Uniprot ID |
P22004 |
Protein Name |
Bone morphogenetic protein 6 |
Protein Accession # |
NP_001709 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001718 |
Tested Species Reactivity |
Human, Rat |
Gene Symbol |
BMP6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 100%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 77% |
Image 1 | Mouse Liver, Mouse Pancreas
| Host: Rabbit Target: BMP6 Positive control (+): Mouse Liver (M-LI) Negative control (-): Mouse Pancreas (M-PA) Antibody concentration: 1ug/ml |
|
Image 2 | Human Placenta
| WB Suggested Anti-BMP6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta |
|
Image 3 | Rat Liver
| Host: Rat Target Name: BMP6 Sample Tissue: Rat Liver Antibody Dilution: 1ug/ml |
|