NGRN Antibody - N-terminal region (ARP58748_P050)

Data Sheet
 
Product Number ARP58748_P050
Product Page www.avivasysbio.com/ngrn-antibody-n-terminal-region-arp58748-p050.html
Name NGRN Antibody - N-terminal region (ARP58748_P050)
Protein Size (# AA) 291 amino acids
Molecular Weight 32kDa
NCBI Gene Id 51335
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Neugrin, neurite outgrowth associated
Alias Symbols DSC92
Peptide Sequence Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ishigaki,S., (2000) Biochem. Biophys. Res. Commun. 279 (2), 526-533
Description of Target NGRN may be involved in neuronal differentiation.
Protein Interactions PRKAG3; ICT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NGRN (ARP58748_P050) antibody
Blocking Peptide For anti-NGRN (ARP58748_P050) antibody is Catalog # AAP58748 (Previous Catalog # AAPP38515)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NGRN
Uniprot ID Q9NPE2-2
Protein Name Neugrin
Protein Accession # NP_001028260
Purification Affinity Purified
Nucleotide Accession # NM_001033088
Tested Species Reactivity Human
Gene Symbol NGRN
Predicted Species Reactivity Human, Rat, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Human: 100%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-NGRN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com