Product Number |
ARP58748_P050 |
Product Page |
www.avivasysbio.com/ngrn-antibody-n-terminal-region-arp58748-p050.html |
Name |
NGRN Antibody - N-terminal region (ARP58748_P050) |
Protein Size (# AA) |
291 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
51335 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Neugrin, neurite outgrowth associated |
Alias Symbols |
DSC92 |
Peptide Sequence |
Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ishigaki,S., (2000) Biochem. Biophys. Res. Commun. 279 (2), 526-533 |
Description of Target |
NGRN may be involved in neuronal differentiation. |
Protein Interactions |
PRKAG3; ICT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NGRN (ARP58748_P050) antibody |
Blocking Peptide |
For anti-NGRN (ARP58748_P050) antibody is Catalog # AAP58748 (Previous Catalog # AAPP38515) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NGRN |
Uniprot ID |
Q9NPE2-2 |
Protein Name |
Neugrin |
Protein Accession # |
NP_001028260 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001033088 |
Tested Species Reactivity |
Human |
Gene Symbol |
NGRN |
Predicted Species Reactivity |
Human, Rat, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Human: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-NGRN Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
|