Product Number |
ARP58727_P050 |
Product Page |
www.avivasysbio.com/tpd52l3-antibody-middle-region-arp58727-p050.html |
Name |
TPD52L3 Antibody - middle region (ARP58727_P050) |
Protein Size (# AA) |
136 amino acids |
Molecular Weight |
15kDa |
NCBI Gene Id |
89882 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tumor protein D52-like 3 |
Alias Symbols |
D55, hD55, TPD55, NYDSP25 |
Peptide Sequence |
Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Cao,Q., (2006) Biochem. Biophys. Res. Commun. 344 (3), 798-806 |
Description of Target |
The exact functions of TPD52L3 remain unknown. |
Protein Interactions |
AGTRAP; CMTM5; APP; TPD52L3; TPD52L2; NFIC; TPD52L1; TPD52; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TPD52L3 (ARP58727_P050) antibody |
Blocking Peptide |
For anti-TPD52L3 (ARP58727_P050) antibody is Catalog # AAP58727 (Previous Catalog # AAPP36423) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3 |
Uniprot ID |
Q96J77-2 |
Protein Name |
Tumor protein D55 |
Protein Accession # |
NP_001001874 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001001874 |
Tested Species Reactivity |
Human |
Gene Symbol |
TPD52L3 |
Predicted Species Reactivity |
Human, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Horse: 79%; Human: 93%; Rabbit: 79% |
Image 1 | Human 293T
| WB Suggested Anti-TPD52L3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate |
|
|