Tfam Antibody - middle region (ARP58723_P050)

Data Sheet
 
Product Number ARP58723_P050
Product Page www.avivasysbio.com/tfam-antibody-middle-region-arp58723-p050.html
Name Tfam Antibody - middle region (ARP58723_P050)
Protein Size (# AA) 243 amino acids
Molecular Weight 28kDa
NCBI Gene Id 21780
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor A, mitochondrial
Alias Symbols Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103
Peptide Sequence Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions C1QBP; SNCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tfam (ARP58723_P050) antibody
Blocking Peptide For anti-Tfam (ARP58723_P050) antibody is Catalog # AAP58723 (Previous Catalog # AAPP36030)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID P40630
Protein Name Transcription factor A, mitochondrial
Protein Accession # NP_033386
Purification Affinity Purified
Nucleotide Accession # NM_009360
Tested Species Reactivity Human, Mouse
Gene Symbol Tfam
Predicted Species Reactivity Mouse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Image 1
Mouse Muscle
WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Muscle
Image 2
Human Placenta
Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-Tfam antibody (ARP58723_P050)
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com