Product Number |
ARP58723_P050 |
Product Page |
www.avivasysbio.com/tfam-antibody-middle-region-arp58723-p050.html |
Name |
Tfam Antibody - middle region (ARP58723_P050) |
Protein Size (# AA) |
243 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
21780 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor A, mitochondrial |
Alias Symbols |
Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103 |
Peptide Sequence |
Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remains unknown. |
Protein Interactions |
C1QBP; SNCA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Tfam (ARP58723_P050) antibody |
Blocking Peptide |
For anti-Tfam (ARP58723_P050) antibody is Catalog # AAP58723 (Previous Catalog # AAPP36030) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P40630 |
Protein Name |
Transcription factor A, mitochondrial |
Protein Accession # |
NP_033386 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009360 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
Tfam |
Predicted Species Reactivity |
Mouse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
Image 1 | Mouse Muscle
| WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Mouse Muscle |
| Image 2 | Human Placenta
| Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-Tfam antibody (ARP58723_P050) |
|
|