| Product Number |
ARP58711_P050 |
| Product Page |
www.avivasysbio.com/daz1-antibody-n-terminal-region-arp58711-p050.html |
| Name |
DAZ1 Antibody - N-terminal region (ARP58711_P050) |
| Protein Size (# AA) |
579 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
1617 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Deleted in azoospermia 1 |
| Alias Symbols |
DAZ, SPGY |
| Peptide Sequence |
Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199 |
| Description of Target |
DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
DZIP1L; BOLL; PUM2; DZIP1; QKI; DAZL; UBC; DAZ1; DZIP3; DAZAP2; DAZAP1; DYNLL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DAZ1 (ARP58711_P050) antibody |
| Blocking Peptide |
For anti-DAZ1 (ARP58711_P050) antibody is Catalog # AAP58711 (Previous Catalog # AAPP35911) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ1 |
| Uniprot ID |
Q9NQZ3 |
| Protein Name |
Deleted in azoospermia protein 1 |
| Protein Accession # |
NP_004072 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004081 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DAZ1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 85%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-DAZ1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
