Product Number |
ARP58694_P050 |
Product Page |
www.avivasysbio.com/flj14803-antibody-n-terminal-region-arp58694-p050.html |
Name |
FLJ14803 Antibody - N-terminal region (ARP58694_P050) |
Protein Size (# AA) |
561 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
84928 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane protein 209 |
Alias Symbols |
NET31 |
Peptide Sequence |
Synthetic peptide located within the following region: MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yamada,T., (2004) Genomics 83 (3), 402-412 |
Description of Target |
The specific function of FLJ14803 is not yet known. |
Protein Interactions |
UBC; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM209 (ARP58694_P050) antibody |
Blocking Peptide |
For anti-TMEM209 (ARP58694_P050) antibody is Catalog # AAP58694 (Previous Catalog # AAPP35942) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14803 |
Uniprot ID |
Q96SK2 |
Protein Name |
Transmembrane protein 209 |
Sample Type Confirmation |
TMEM209 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_116231 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032842 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM209 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-FLJ14803 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 2 | Human Jurkat
| Host: Rabbit Target Name: TMEM209 Sample Type: Human Jurkat Antibody Dilution: 1.0ug/mlTMEM209 is supported by BioGPS gene expression data to be expressed in Jurkat |
|