FLJ14803 Antibody - N-terminal region (ARP58694_P050)

Data Sheet
 
Product Number ARP58694_P050
Product Page www.avivasysbio.com/flj14803-antibody-n-terminal-region-arp58694-p050.html
Name FLJ14803 Antibody - N-terminal region (ARP58694_P050)
Protein Size (# AA) 561 amino acids
Molecular Weight 62kDa
NCBI Gene Id 84928
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transmembrane protein 209
Alias Symbols NET31
Peptide Sequence Synthetic peptide located within the following region: MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yamada,T., (2004) Genomics 83 (3), 402-412
Description of Target The specific function of FLJ14803 is not yet known.
Protein Interactions UBC; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM209 (ARP58694_P050) antibody
Blocking Peptide For anti-TMEM209 (ARP58694_P050) antibody is Catalog # AAP58694 (Previous Catalog # AAPP35942)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14803
Uniprot ID Q96SK2
Protein Name Transmembrane protein 209
Sample Type Confirmation

TMEM209 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_116231
Purification Affinity Purified
Nucleotide Accession # NM_032842
Tested Species Reactivity Human
Gene Symbol TMEM209
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Muscle
WB Suggested Anti-FLJ14803 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 2
Human Jurkat
Host: Rabbit
Target Name: TMEM209
Sample Type: Human Jurkat
Antibody Dilution: 1.0ug/mlTMEM209 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com