TSTA3 Antibody - N-terminal region (ARP58679_P050)

• Product Number: ARP58679_P050
• Name: TSTA3 Antibody - N-terminal region (ARP58679_P050)
• Protein Size (# AA): 321 amino acids
• Molecular Weight: 36 kDa
• NCBI Gene Id: 7264
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tissue specific transplantation antigen P35B
• Alias Symbols: FX, P35B, TSTA3, SDR4E1
• Peptide Sequence: Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Roos,C., (2002) J. Biol. Chem. 277 (5), 3168-3175
• Description of Target: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.
• Protein Interactions: UBC; COASY; EFHD2; PPME1; GLRX3; GMPS; RCN1; RBBP7; BAG3; RIOK2; ID2; DNAJC9; DSTN; NEDD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TSTA3 (ARP58679_P050) antibody is Catalog # AAP58679 (Previous Catalog # AAPP35926)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSTA3
• Uniprot ID: Q13630
• Protein Name: GDP-L-fucose synthase
• Sample Type Confirmation:

  TSTA3 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HeLa

  TSTA3 is supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_003304
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003313
• Tested Species Reactivity: Human
• Gene Symbol: TSTA3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Adult Liver
  
  Rabbit Anti-TSTA3 Antibody
  Catalog Number: ARP58679_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 2:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.