SPACA4 Antibody - N-terminal region (ARP58662_P050)

Data Sheet
 
Product Number ARP58662_P050
Product Page www.avivasysbio.com/spaca4-antibody-n-terminal-region-arp58662-p050.html
Name SPACA4 Antibody - N-terminal region (ARP58662_P050)
Protein Size (# AA) 124 amino acids
Molecular Weight 14kDa
NCBI Gene Id 171169
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sperm acrosome associated 4
Alias Symbols SAMP14
Peptide Sequence Synthetic peptide located within the following region: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SPACA4 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SPACA4 (ARP58662_P050) antibody
Blocking Peptide For anti-SPACA4 (ARP58662_P050) antibody is Catalog # AAP58662
Uniprot ID Q8TDM5
Protein Name Sperm acrosome membrane-associated protein 4
Protein Accession # NP_598005
Purification Affinity Purified
Nucleotide Accession # NM_133498
Tested Species Reactivity Human
Gene Symbol SPACA4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rat: 79%
Image 1
Human Jurkat
WB Suggested Anti-SPACA4 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com