NT5C1B Antibody - N-terminal region (ARP58646_P050)

• Name: NT5C1B Antibody - N-terminal region (ARP58646_P050)
• Protein Size (# AA): 550 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 93034
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5'-nucleotidase, cytosolic IB
• Alias Symbols: AIRP, CN1B, CN-IB
• Peptide Sequence: Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wang,A. Biochim. Biophys. Acta 1521 (1-3), 12-18 (2001)
• Description of Target: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NT5C1B (ARP58646_P050) antibody is Catalog # AAP58646 (Previous Catalog # AAPP35783)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B
• Uniprot ID: B7ZVX7
• Protein Name: Cytosolic 5'-nucleotidase 1B
• Protein Accession #: NP_150278
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033253
• Tested Species Reactivity: Human
• Gene Symbol: NT5C1B
• Predicted Species Reactivity: Human, Mouse, Rat, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%
• Image 1: Human Liver
  
  WB Suggested Anti-NT5C1B Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Liver