| Product Number |
ARP58634_P050 |
| Product Page |
www.avivasysbio.com/hcg-1745121-antibody-n-terminal-region-arp58634-p050.html |
| Name |
hCG_1745121 Antibody - N-terminal region (ARP58634_P050) |
| Protein Size (# AA) |
401 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
729920 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Isoprenoid synthase domain containing |
| Alias Symbols |
Nip, ISPD, hISPD, MDDGA7, MDDGC7, LGMDR20 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Venter,J.C., (2001) Science 291 (5507), 1304-1351 |
| Description of Target |
The specific function of hCG_1745121 is not yet known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ISPD (ARP58634_P050) antibody |
| Blocking Peptide |
For anti-ISPD (ARP58634_P050) antibody is Catalog # AAP58634 (Previous Catalog # AAPP35771) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_1745121 |
| Uniprot ID |
A4D126 |
| Protein Name |
Isoprenoid synthase domain-containing protein |
| Protein Accession # |
NP_001094887 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001101417 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ISPD |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Lung
 | WB Suggested Anti-hCG_1745121 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung |
|
|
