GLRX3 Antibody - N-terminal region (ARP58626_P050)

Data Sheet
 
Product Number ARP58626_P050
Product Page www.avivasysbio.com/glrx3-antibody-n-terminal-region-arp58626-p050.html
Name GLRX3 Antibody - N-terminal region (ARP58626_P050)
Protein Size (# AA) 335 amino acids
Molecular Weight 37kDa
NCBI Gene Id 10539
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glutaredoxin 3
Alias Symbols GRX3, GRX4, GLRX4, PICOT, TXNL2, TXNL3
Peptide Sequence Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target GLRX3 may play a role in regulating the function of the thioredoxin system.
Protein Interactions KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; LCE2D; TRIM42; ALKBH3; KRTAP13-1; OLFM3; KRTAP4-2; KRTAP4-7; TMEM25; KRTAP9-2; KRTAP4-12; SOX7; ZNF426; GMCL1; CIAPIN1; TRIM36; FAM118A; BOLA1; ZBTB44; ZNF544; MOXD1; MAPKBP1; GLRX3; IKZF1; KRT38; RG
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GLRX3 (ARP58626_P050) antibody
Blocking Peptide For anti-GLRX3 (ARP58626_P050) antibody is Catalog # AAP58626 (Previous Catalog # AAPP35763)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX3
Uniprot ID O76003
Protein Name Glutaredoxin-3
Sample Type Confirmation

GLRX3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006532
Purification Affinity Purified
Nucleotide Accession # NM_006541
Tested Species Reactivity Human
Gene Symbol GLRX3
Predicted Species Reactivity Human, Mouse, Cow, Dog, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Human: 100%; Mouse: 85%; Pig: 93%
Image 1
Human HepG2
WB Suggested Anti-GLRX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateGLRX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com