Product Number |
ARP58624_P050 |
Product Page |
www.avivasysbio.com/fn3krp-antibody-n-terminal-region-arp58624-p050.html |
Name |
FN3KRP Antibody - N-terminal region (ARP58624_P050) |
Protein Size (# AA) |
309 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
79672 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Fructosamine 3 kinase related protein |
Alias Symbols |
FN3KL |
Peptide Sequence |
Synthetic peptide located within the following region: MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Szwergold,B., (2007) Biochem. Biophys. Res. Commun. 361 (4), 870-875 |
Description of Target |
FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM]. |
Protein Interactions |
APP; CUL3; CUL4B; UBC; USP43; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FN3KRP (ARP58624_P050) antibody |
Blocking Peptide |
For anti-FN3KRP (ARP58624_P050) antibody is Catalog # AAP58624 (Previous Catalog # AAPP35761) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FN3KRP |
Uniprot ID |
Q9HA64 |
Protein Name |
Ketosamine-3-kinase |
Sample Type Confirmation |
FN3KRP is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_078895 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024619 |
Tested Species Reactivity |
Human |
Gene Symbol |
FN3KRP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Zebrafish: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-FN3KRP Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysateFN3KRP is supported by BioGPS gene expression data to be expressed in Jurkat |
|