FN3KRP Antibody - N-terminal region (ARP58624_P050)

Data Sheet
 
Product Number ARP58624_P050
Product Page www.avivasysbio.com/fn3krp-antibody-n-terminal-region-arp58624-p050.html
Name FN3KRP Antibody - N-terminal region (ARP58624_P050)
Protein Size (# AA) 309 amino acids
Molecular Weight 34kDa
NCBI Gene Id 79672
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Fructosamine 3 kinase related protein
Alias Symbols FN3KL
Peptide Sequence Synthetic peptide located within the following region: MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Szwergold,B., (2007) Biochem. Biophys. Res. Commun. 361 (4), 870-875
Description of Target FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM].
Protein Interactions APP; CUL3; CUL4B; UBC; USP43;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FN3KRP (ARP58624_P050) antibody
Blocking Peptide For anti-FN3KRP (ARP58624_P050) antibody is Catalog # AAP58624 (Previous Catalog # AAPP35761)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FN3KRP
Uniprot ID Q9HA64
Protein Name Ketosamine-3-kinase
Sample Type Confirmation

FN3KRP is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_078895
Purification Affinity Purified
Nucleotide Accession # NM_024619
Tested Species Reactivity Human
Gene Symbol FN3KRP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Image 1
Human Jurkat
WB Suggested Anti-FN3KRP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateFN3KRP is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com