FLJ20433 Antibody - N-terminal region (ARP58623_P050)

Data Sheet
 
Product Number ARP58623_P050
Product Page https://www.avivasysbio.com/flj20433-antibody-n-terminal-region-arp58623-p050.html
Name FLJ20433 Antibody - N-terminal region (ARP58623_P050)
Protein Size (# AA) 758 amino acids
Molecular Weight 83kDa
NCBI Gene Id 54932
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Exonuclease 3'-5' domain containing 3
Alias Symbols Nbr, mut-7
Peptide Sequence Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target The specific function of FLJ20433 is not yet known.
Protein Interactions EXD3; DAZAP2; CUL1; PLSCR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EXD3 (ARP58623_P050) antibody
Blocking Peptide For anti-EXD3 (ARP58623_P050) antibody is Catalog # AAP58623 (Previous Catalog # AAPP35820)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433
Uniprot ID Q8N9H8
Protein Name Probable exonuclease mut-7 homolog
Protein Accession # NP_060290
Purification Affinity Purified
Nucleotide Accession # NM_017820
Tested Species Reactivity Human
Gene Symbol EXD3
Predicted Species Reactivity Human, Goat
Application WB
Predicted Homology Based on Immunogen Sequence Goat: 92%; Human: 100%
Image 1
Human Heart
WB Suggested Anti-FLJ20433 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart