Product Number |
ARP58623_P050 |
Product Page |
https://www.avivasysbio.com/flj20433-antibody-n-terminal-region-arp58623-p050.html |
Name |
FLJ20433 Antibody - N-terminal region (ARP58623_P050) |
Protein Size (# AA) |
758 amino acids |
Molecular Weight |
83kDa |
NCBI Gene Id |
54932 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Exonuclease 3'-5' domain containing 3 |
Alias Symbols |
Nbr, mut-7 |
Peptide Sequence |
Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
The specific function of FLJ20433 is not yet known. |
Protein Interactions |
EXD3; DAZAP2; CUL1; PLSCR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EXD3 (ARP58623_P050) antibody |
Blocking Peptide |
For anti-EXD3 (ARP58623_P050) antibody is Catalog # AAP58623 (Previous Catalog # AAPP35820) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433 |
Uniprot ID |
Q8N9H8 |
Protein Name |
Probable exonuclease mut-7 homolog |
Protein Accession # |
NP_060290 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017820 |
Tested Species Reactivity |
Human |
Gene Symbol |
EXD3 |
Predicted Species Reactivity |
Human, Goat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Goat: 92%; Human: 100% |
Image 1 | Human Heart
 | WB Suggested Anti-FLJ20433 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
|
|