CAMKV Antibody - N-terminal region (ARP58602_P050)

• Product Number: ARP58602_P050
• Name: CAMKV Antibody - N-terminal region (ARP58602_P050)
• Protein Size (# AA): 501 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 79012
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CaM kinase-like vesicle-associated
• Alias Symbols: 1G5, VACAMKL
• Peptide Sequence: Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ballif,B.A., (2004) Mol. Cell Proteomics 3 (11), 1093-1101
• Description of Target: CAMKV does not appear to have detectable kinase activity.
• Protein Interactions: HSP90AA1; APP; COPS5; UBC; TCEA2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CAMKV (ARP58602_P050) antibody is Catalog # AAP58602 (Previous Catalog # AAPP35739)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV
• Uniprot ID: Q8NCB2
• Protein Name: CaM kinase-like vesicle-associated protein
• Protein Accession #: NP_076951
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024046
• Tested Species Reactivity: Human
• Gene Symbol: CAMKV
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Image 1: Human 721_B
  
  WB Suggested Anti-CAMKV Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 721_B cell lysate