Product Number |
ARP58600_P050 |
Product Page |
www.avivasysbio.com/calb2-antibody-n-terminal-region-arp58600-p050.html |
Name |
CALB2 Antibody - N-terminal region (ARP58600_P050) |
Protein Size (# AA) |
271 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
794 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calbindin 2 |
Alias Symbols |
CR, CAL2, CAB29 |
Peptide Sequence |
Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Alaeddini,M., (2008) Histopathology 52 (3), 299-304 |
Description of Target |
CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described. |
Protein Interactions |
UBC; TUBA4A; KRT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CALB2 (ARP58600_P050) antibody |
Blocking Peptide |
For anti-CALB2 (ARP58600_P050) antibody is Catalog # AAP58600 (Previous Catalog # AAPP35737) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2 |
Uniprot ID |
P22676 |
Protein Name |
Calretinin |
Protein Accession # |
NP_001731 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001740 |
Tested Species Reactivity |
Human |
Gene Symbol |
CALB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human MCF-7
| WB Suggested Anti-CALB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: MCF7 cell lysate |
|
|