CALB2 Antibody - N-terminal region (ARP58600_P050)

Data Sheet
 
Product Number ARP58600_P050
Product Page www.avivasysbio.com/calb2-antibody-n-terminal-region-arp58600-p050.html
Name CALB2 Antibody - N-terminal region (ARP58600_P050)
Protein Size (# AA) 271 amino acids
Molecular Weight 30kDa
NCBI Gene Id 794
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calbindin 2
Alias Symbols CR, CAL2, CAB29
Peptide Sequence Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Alaeddini,M., (2008) Histopathology 52 (3), 299-304
Description of Target CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.
Protein Interactions UBC; TUBA4A; KRT1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CALB2 (ARP58600_P050) antibody
Blocking Peptide For anti-CALB2 (ARP58600_P050) antibody is Catalog # AAP58600 (Previous Catalog # AAPP35737)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2
Uniprot ID P22676
Protein Name Calretinin
Protein Accession # NP_001731
Purification Affinity Purified
Nucleotide Accession # NM_001740
Tested Species Reactivity Human
Gene Symbol CALB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human MCF-7
WB Suggested Anti-CALB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com